PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 311286
Common NameARALYDRAFT_311286
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 1249aa    MW: 138306 Da    PI: 6.4635
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
311286genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.43.4e-1310591103147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding    1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                       r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
           311286 1059 RENWTEQEHDKFLEALHLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 1103
                       789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd052994.76E-94352670No hitNo description
Gene3DG3DSA:3.40.50.7201.2E-5388459IPR016040NAD(P)-binding domain
SuperFamilySSF517352.43E-33447640IPR016040NAD(P)-binding domain
PfamPF028262.1E-27455637IPR006140D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding domain
Gene3DG3DSA:3.40.50.7205.5E-39460642IPR016040NAD(P)-binding domain
SuperFamilySSF466899.72E-1610531109IPR009057Homeodomain-like
PROSITE profilePS5129415.50710541108IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-610571109IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-1710571106IPR006447Myb domain, plants
SMARTSM007172.9E-1110581106IPR001005SANT/Myb domain
PfamPF002496.1E-1110591103IPR001005SANT/Myb domain
CDDcd001677.31E-810611104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000226Biological Processmicrotubule cytoskeleton organization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008360Biological Processregulation of cell shape
GO:0009965Biological Processleaf morphogenesis
GO:0010091Biological Processtrichome branching
GO:0010482Biological Processregulation of epidermal cell division
GO:0031129Biological Processinductive cell-cell signaling
GO:0042814Biological Processmonopolar cell growth
GO:0045604Biological Processregulation of epidermal cell differentiation
GO:0048444Biological Processfloral organ morphogenesis
GO:0048530Biological Processfruit morphogenesis
GO:0055114Biological Processoxidation-reduction process
GO:2000039Biological Processregulation of trichome morphogenesis
GO:0005634Cellular Componentnucleus
GO:0005802Cellular Componenttrans-Golgi network
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0051287Molecular FunctionNAD binding
Sequence ? help Back to Top
Protein Sequence    Length: 1249 aa     Download sequence    Send to blast
MISKDHNHHQ DPLGTTKSYN MKTSAVSPPP SSTSSIALSQ SAWLEVRLFY VRIAPCVVEN  60
VPDFLTLRHP RRETGASLEV NGVRVPSSQT ASLKLRRDRV DRESSEVTYV STETVRVTGC  120
VDFEVYDNDD MVLCGNLDRI EGAWNNGTVS DPKTGWGMDC YIAMGNGHVS GPSSSAFFQP  180
KLGVSSPSVE VYIAGCCGGV PVILTKTIQA SPRRKVARHV TLDAIPEDEE VGKEQDIGTI  240
GDELARQSKV QMMESEVDDY DESEMKMAQR YYPEGMYVDE DGQLSWFNAG VRVGVGIGLG  300
MCLGVGIGVG LLMRSYQATT SNLRRSEKKK EMSKIRSSAT MPHRDQPSPA SPHVVTLNCI  360
EDCALEQDSL AGVAGVEYVP LSRIADGKIE SATAVLLHSL AYLPRAAQRR LRPHQLILCL  420
GSADRAVDST LAADLGLRLV HVDTSRAEEI ADTVMALILG LLRRTHLLSR HALSASGWLG  480
SLQPLCRGMR RCRGMVLGIV GRSVSARYLA SRSLAFKMSV LYFDVPEGDE DRIRPSRFPR  540
AARRMDTLND LLAASDVISL HCALTDDTVQ ILNAECLQHI KPGAFLVNTG SCQLLDDCAV  600
KQLLIDGTIA GCALDGAEGP QWMEAWVKEM PNVLILPRSA DYSEEVWMEI REKAISILHS  660
FFLDGVIPSN TVSDEEIEES EASEEEEQSP IKHEKLAIVE STSRQQGEST LTSTEIVHRE  720
ASELKESLSP GQQHVSQNTA VKPEGRRSRS GKKAKKRHSQ QKYMQKAEGS SGLNEESTSR  780
RDDIAMSDTE EVLSSSSRCA SPEDSRSRKT PLEVMQESSP SQLVMSSKKF IGKSSELLKD  840
GYVVALYAKD LSGLHVSRQR TKNGGWFLDT LSNVSKRDPA AQFIIAYRNK DTVGLRSFAA  900
GGKLLQINRR MEFVFASHSF DVWESWSLEG SLDECRLVNC RNSSAVLDVR VEILAMVGDD  960
AETSDELVLE GRLLLFYGSG RDELESIVCL GSLCVFSRFM VTVNPSQAHC LPMSMNLPGY  1020
NTLAHTATTM PVSIRSNTMS FFEDPTKKIR KPYTITKSRE NWTEQEHDKF LEALHLFDRD  1080
WKKIEAFVGS KTVIQIRSHA QKYFLKVQKN GTKEHYLYST NSHPCKHGLV RSDVNIPTTV  1140
IKEELGGSEN CCSTTSSSRD KQRTRTVTET NDQESCGKPH RVTPNFAEVY SFIGSVFDPK  1200
TTGHVQRLKE MDPTNLETVL LLMRNLSVNL TSPEFEEQRM LISSYNAR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2hu2_A5e-333326549328C-terminal-binding protein 1
1hl3_A5e-333326549328C-TERMINAL BINDING PROTEIN 3
1hku_A5e-333326549328C-TERMINAL BINDING PROTEIN 3
3ga0_A5e-333326549328C-terminal-binding protein 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1323329RRSEKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0320600.0AB032060.1 Arabidopsis thaliana mRNA for C-terminal binding protein, complete cds.
GenBankY100860.0Y10086.1 Arabidopsis thaliana gene encoding putative dehydrogenase.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002892061.10.0hypothetical protein ARALYDRAFT_311286
SwissprotO237020.0CTBP_ARATH; C-terminal binding protein AN
TrEMBLD7KQ660.0D7KQ66_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_10000660.0(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01520.11e-149MYB_related family protein